Lineage for d2mhbb_ (2mhb B:)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.1: Globin-like [46457] (2 superfamilies) Superfamily a.1.1: Globin-like [46458] (3 families) 
Family a.1.1.2: Globins [46463] (16 proteins) 
Protein Hemoglobin, beta-chain [46500] (15 species) 
Species Horse (Equus caballus) [TaxId:9796] [46504] (4 PDB entries) 
Domain d2mhbb_: 2mhb B: [15555]
Other proteins in same PDB: d2mhba_
Details for d2mhbb_
PDB Entry: 2mhb (more details), 2 Å
PDB Description: the structure of horse methaemoglobin at 2.0 angstroms resolution
SCOP Domain Sequences for d2mhbb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2mhbb_ a.1.1.2 (B:) Hemoglobin, beta-chain {Horse (Equus caballus)}
vqlsgeekaavlalwdkvneeevggealgrllvvypwtqrffdsfgdlsnpgavmgnpkv
kahgkkvlhsfgegvhhldnlkgtfaalselhcdklhvdpenfrllgnvlvvvlarhfgk
dftpelqasyqkvvagvanalahkyh
SCOP Domain Coordinates for d2mhbb_:
Click to download the PDB-style file with coordinates for d2mhbb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2mhbb_:
- d2mhbb_ appears in SCOP 1.57
- d2mhbb_ appears in the current release, SCOPe 2.08
View in 3D
