Lineage for d2mhbb_ (2mhb B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2685963Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2687001Protein Hemoglobin, beta-chain [46500] (26 species)
  7. 2687104Species Horse (Equus caballus) [TaxId:9796] [46504] (19 PDB entries)
  8. 2687111Domain d2mhbb_: 2mhb B: [15555]
    Other proteins in same PDB: d2mhba_
    complexed with hem

Details for d2mhbb_

PDB Entry: 2mhb (more details), 2 Å

PDB Description: the structure of horse methaemoglobin at 2.0 angstroms resolution
PDB Compounds: (B:) hemoglobin (aquo met) (beta chain)

SCOPe Domain Sequences for d2mhbb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2mhbb_ a.1.1.2 (B:) Hemoglobin, beta-chain {Horse (Equus caballus) [TaxId: 9796]}
vqlsgeekaavlalwdkvneeevggealgrllvvypwtqrffdsfgdlsnpgavmgnpkv
kahgkkvlhsfgegvhhldnlkgtfaalselhcdklhvdpenfrllgnvlvvvlarhfgk
dftpelqasyqkvvagvanalahkyh

SCOPe Domain Coordinates for d2mhbb_:

Click to download the PDB-style file with coordinates for d2mhbb_.
(The format of our PDB-style files is described here.)

Timeline for d2mhbb_: