Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.1: Parallel coiled-coil [57943] (41 superfamilies) this is not a true fold; includes oligomers of shorter identical helices |
Superfamily h.1.15: SNARE fusion complex [58038] (2 families) tetrameric parallel coiled coil |
Family h.1.15.1: SNARE fusion complex [58039] (12 proteins) |
Protein Syntaxin 1A [88908] (3 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [161254] (1 PDB entry) |
Domain d3b5nj_: 3b5n J: [154850] Other proteins in same PDB: d3b5na2, d3b5na3, d3b5nc2, d3b5nc3, d3b5nc4, d3b5ne_, d3b5ng1, d3b5ng2, d3b5ni_, d3b5nk_ automated match to d3b5nb_ |
PDB Entry: 3b5n (more details), 1.6 Å
SCOPe Domain Sequences for d3b5nj_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3b5nj_ h.1.15.1 (J:) Syntaxin 1A {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} aevqarhqellkleksmaeltqlfndmeelvieqqenvdvidknvedaqldveqgvghtd kavk
Timeline for d3b5nj_: