SCOPe 2.08: Domain d3b5na2: 3b5n A:27-86

Lineage for d3b5na2 (3b5n A:27-86)

1. Root: SCOPe 2.08

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
   this is not a true fold; includes oligomers of shorter identical helices

4. Superfamily h.1.15: SNARE fusion complex [58038] (2 families)
   tetrameric parallel coiled coil

5. Family h.1.15.1: SNARE fusion complex [58039] (12 proteins)

6. Protein Synaptobrevin [88903] (3 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [161253] (1 PDB entry)

8. Domain d3b5na2: 3b5n A:27-86 [154846]
   Other proteins in same PDB: d3b5na3, d3b5nb_, d3b5nc2, d3b5nc3, d3b5nc4, d3b5nf_, d3b5ng1, d3b5ng2, d3b5nj_, d3b5nk_
   automated match to d3b5na1

Details for d3b5na2

PDB Entry: 3b5n, 1.6 Å

PDB Description: structure of the yeast plasma membrane snare complex

PDB Compounds: (A:) synaptobrevin homolog 1

SCOPe Domain Sequences for d3b5na2:

Sequence; same for both SEQRES and ATOM records:

>d3b5na2 h.1.15.1 (A:27-86) Synaptobrevin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
srtaelqaeiddtvgimrdninkvaergerltsiedkadnlavsaqgfkrganrvrkamw

Timeline for d3b5na2:

• d3b5na2 first appeared in SCOP 1.75, called d3b5na1
  
• d3b5na2 appears in SCOPe 2.07