Lineage for d3b5nk_ (3b5n K:)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3039231Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 3040219Superfamily h.1.15: SNARE fusion complex [58038] (2 families) (S)
    tetrameric parallel coiled coil
  5. 3040220Family h.1.15.1: SNARE fusion complex [58039] (12 proteins)
  6. 3040322Protein automated matches [254664] (2 species)
    not a true protein
  7. 3040323Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [255760] (1 PDB entry)
  8. 3040326Domain d3b5nk_: 3b5n K: [239156]
    Other proteins in same PDB: d3b5na2, d3b5na3, d3b5nb_, d3b5nc3, d3b5nc4, d3b5ne_, d3b5nf_, d3b5ng2, d3b5ni_, d3b5nj_
    automated match to d1urqc_

Details for d3b5nk_

PDB Entry: 3b5n (more details), 1.6 Å

PDB Description: structure of the yeast plasma membrane snare complex
PDB Compounds: (K:) Protein transport protein SEC9

SCOPe Domain Sequences for d3b5nk_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3b5nk_ h.1.15.1 (K:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
kftkqssvastrntlkmaqdaeragmntlgmlghqseqlnnvegnldlmkvqnkvadekv
aelkk

SCOPe Domain Coordinates for d3b5nk_:

Click to download the PDB-style file with coordinates for d3b5nk_.
(The format of our PDB-style files is described here.)

Timeline for d3b5nk_: