Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.55: Ribosomal protein L22 [54842] (1 superfamily) beta-alpha(3)-beta(2); 2 layers: alpha/beta; related to the enolase/MLE N-domain fold by a circular permutation |
Superfamily d.55.1: Ribosomal protein L22 [54843] (1 family) some topological similarity to prokaryotic ribosomal protein L17 |
Family d.55.1.1: Ribosomal protein L22 [54844] (1 protein) |
Protein Ribosomal protein L22 [54845] (5 species) |
Species Deinococcus radiodurans [TaxId:1299] [160265] (6 PDB entries) Uniprot Q9RXJ7 8-134 |
Domain d2zjqp1: 2zjq P:8-134 [154540] Other proteins in same PDB: d2zjq11, d2zjq21, d2zjq31, d2zjq41, d2zjq51, d2zjqa1, d2zjqa2, d2zjqb1, d2zjqc1, d2zjqd1, d2zjqe1, d2zjqe2, d2zjqf1, d2zjqf2, d2zjqg1, d2zjqh1, d2zjqi1, d2zjqj1, d2zjqk1, d2zjql1, d2zjqm1, d2zjqn1, d2zjqo1, d2zjqq1, d2zjqr1, d2zjqs1, d2zjqt1, d2zjqu1, d2zjqv1, d2zjqw1, d2zjqz1 automatically matched to 2ZJR P:8-134 protein/RNA complex |
PDB Entry: 2zjq (more details), 3.3 Å
SCOPe Domain Sequences for d2zjqp1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zjqp1 d.55.1.1 (P:8-134) Ribosomal protein L22 {Deinococcus radiodurans [TaxId: 1299]} frnkkqrkqqvklrkpgfavakyvrmsprkvrlvvdvirgksvqdaedllrfiprsasep vakvlnsakanalhndemledrlfvkeayvdagptlkrliprargsaniikkrtshitii vaekgnk
Timeline for d2zjqp1:
View in 3D Domains from other chains: (mouse over for more information) d2zjq11, d2zjq21, d2zjq31, d2zjq41, d2zjq51, d2zjqa1, d2zjqa2, d2zjqb1, d2zjqc1, d2zjqd1, d2zjqe1, d2zjqe2, d2zjqf1, d2zjqf2, d2zjqg1, d2zjqh1, d2zjqi1, d2zjqj1, d2zjqk1, d2zjql1, d2zjqm1, d2zjqn1, d2zjqo1, d2zjqq1, d2zjqr1, d2zjqs1, d2zjqt1, d2zjqu1, d2zjqv1, d2zjqw1, d2zjqz1 |