![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.155: L21p-like [141090] (1 superfamily) core: sandwich, 6 strands in 2 sheets |
![]() | Superfamily b.155.1: L21p-like [141091] (1 family) ![]() automatically mapped to Pfam PF00829 |
![]() | Family b.155.1.1: Ribosomal protein L21p [141092] (1 protein) Pfam PF00829 |
![]() | Protein Ribosomal protein L21p [141093] (3 species) |
![]() | Species Deinococcus radiodurans [TaxId:1299] [158938] (6 PDB entries) Uniprot Q9RY64 5-98 |
![]() | Domain d2zjqo1: 2zjq O:5-98 [154539] Other proteins in same PDB: d2zjq11, d2zjq21, d2zjq31, d2zjq41, d2zjq51, d2zjqa1, d2zjqa2, d2zjqb1, d2zjqc1, d2zjqd1, d2zjqe1, d2zjqe2, d2zjqf1, d2zjqf2, d2zjqg1, d2zjqh1, d2zjqi1, d2zjqj1, d2zjqk1, d2zjql1, d2zjqm1, d2zjqn1, d2zjqp1, d2zjqq1, d2zjqr1, d2zjqs1, d2zjqt1, d2zjqu1, d2zjqv1, d2zjqw1, d2zjqz1 automatically matched to 2ZJR O:5-98 protein/RNA complex |
PDB Entry: 2zjq (more details), 3.3 Å
SCOPe Domain Sequences for d2zjqo1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zjqo1 b.155.1.1 (O:5-98) Ribosomal protein L21p {Deinococcus radiodurans [TaxId: 1299]} iqtggkqyrvsegdvirveslqgeagdkvelkalfvggeqtvfgedagkytvqaevvehg rgkkiyirkyksgvqyrrrtghrqnftaikilgi
Timeline for d2zjqo1:
![]() Domains from other chains: (mouse over for more information) d2zjq11, d2zjq21, d2zjq31, d2zjq41, d2zjq51, d2zjqa1, d2zjqa2, d2zjqb1, d2zjqc1, d2zjqd1, d2zjqe1, d2zjqe2, d2zjqf1, d2zjqf2, d2zjqg1, d2zjqh1, d2zjqi1, d2zjqj1, d2zjqk1, d2zjql1, d2zjqm1, d2zjqn1, d2zjqp1, d2zjqq1, d2zjqr1, d2zjqs1, d2zjqt1, d2zjqu1, d2zjqv1, d2zjqw1, d2zjqz1 |