SCOPe 2.08: Domain d2zjqg1: 2zjq G:30-171

Lineage for d2zjqg1 (2zjq G:30-171)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.21: Ribosomal protein L13 [52160] (1 superfamily)
   3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 3214

4. Superfamily c.21.1: Ribosomal protein L13 [52161] (1 family)

5. Family c.21.1.1: Ribosomal protein L13 [52162] (1 protein)

6. Protein Ribosomal protein L13 [52163] (5 species)
   synonym: 50S ribosomal protein L13p, HMAL13

7. Species Deinococcus radiodurans [TaxId:1299] [159475] (6 PDB entries)
   Uniprot Q9RXY1 30-171

8. Domain d2zjqg1: 2zjq G:30-171 [154531]
   Other proteins in same PDB: d2zjq11, d2zjq21, d2zjq31, d2zjq41, d2zjq51, d2zjqa1, d2zjqa2, d2zjqb1, d2zjqc1, d2zjqd1, d2zjqe1, d2zjqe2, d2zjqf1, d2zjqf2, d2zjqh1, d2zjqi1, d2zjqj1, d2zjqk1, d2zjql1, d2zjqm1, d2zjqn1, d2zjqo1, d2zjqp1, d2zjqq1, d2zjqr1, d2zjqs1, d2zjqt1, d2zjqu1, d2zjqv1, d2zjqw1, d2zjqz1
   automatically matched to 2ZJR G:30-171
   protein/RNA complex

Details for d2zjqg1

PDB Entry: 2zjq, 3.3 Å

PDB Description: Interaction of L7 with L11 induced by Microccocin binding to the Deinococcus radiodurans 50S subunit

PDB Compounds: (G:) 50S ribosomal protein L13

SCOPe Domain Sequences for d2zjqg1:

Sequence; same for both SEQRES and ATOM records:

>d2zjqg1 c.21.1.1 (G:30-171) Ribosomal protein L13 {Deinococcus radiodurans [TaxId: 1299]}
ktyipkndeqnwvvvdasgvplgrlatliasrirgkhrpdftpnmiqgdfvvvinaaqva
ltgkklddkvytrytgyqgglktetarealskhperviehavfgmlpkgrqgramhtrlk
vyagethphsaqkpqvlktqpl

Timeline for d2zjqg1:

• d2zjqg1 first appeared in SCOP 1.75
  
• d2zjqg1 appears in SCOPe 2.07