Lineage for d2zjq31 (2zjq 3:2-64)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2566587Fold d.301: L35p-like [143033] (1 superfamily)
    core: alpha-beta(3)-alpha; 2layers a/b
  4. 2566588Superfamily d.301.1: L35p-like [143034] (1 family) (S)
    automatically mapped to Pfam PF01632
  5. 2566589Family d.301.1.1: Ribosomal protein L35p [143035] (1 protein)
    Pfam PF01632
  6. 2566590Protein Ribosomal protein L35p [143036] (3 species)
  7. 2566591Species Deinococcus radiodurans [TaxId:1299] [160056] (6 PDB entries)
    Uniprot Q9RSW6 2-64
  8. 2566595Domain d2zjq31: 2zjq 3:2-64 [154519]
    Other proteins in same PDB: d2zjq11, d2zjq21, d2zjq41, d2zjq51, d2zjqa1, d2zjqa2, d2zjqb1, d2zjqc1, d2zjqd1, d2zjqe1, d2zjqe2, d2zjqf1, d2zjqf2, d2zjqg1, d2zjqh1, d2zjqi1, d2zjqj1, d2zjqk1, d2zjql1, d2zjqm1, d2zjqn1, d2zjqo1, d2zjqp1, d2zjqq1, d2zjqr1, d2zjqs1, d2zjqt1, d2zjqu1, d2zjqv1, d2zjqw1, d2zjqz1
    automatically matched to 2ZJR 3:2-64
    protein/RNA complex

Details for d2zjq31

PDB Entry: 2zjq (more details), 3.3 Å

PDB Description: Interaction of L7 with L11 induced by Microccocin binding to the Deinococcus radiodurans 50S subunit
PDB Compounds: (3:) 50S ribosomal protein L35

SCOPe Domain Sequences for d2zjq31:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zjq31 d.301.1.1 (3:2-64) Ribosomal protein L35p {Deinococcus radiodurans [TaxId: 1299]}
pkmkthkmakrrikitgtgkvmafksgkrhqntgksgdeirgkgkgfvlakaewarmklm
lpr

SCOPe Domain Coordinates for d2zjq31:

Click to download the PDB-style file with coordinates for d2zjq31.
(The format of our PDB-style files is described here.)

Timeline for d2zjq31: