Lineage for d2zjq51 (2zjq 5:52-122)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2946590Fold d.45: ClpS-like [54735] (1 superfamily)
    beta-alpha(2)-beta-alpha-beta; 2 layers, alpha/beta
  4. 2946591Superfamily d.45.1: ClpS-like [54736] (3 families) (S)
  5. 2946592Family d.45.1.1: Ribosomal protein L7/12, C-terminal domain [54737] (1 protein)
    automatically mapped to Pfam PF00542
  6. 2946593Protein Ribosomal protein L7/12, C-terminal domain [54738] (3 species)
  7. 2946594Species Deinococcus radiodurans [TaxId:1299] [160198] (1 PDB entry)
    Uniprot Q9RST0 52-122
  8. 2946595Domain d2zjq51: 2zjq 5:52-122 [154521]
    Other proteins in same PDB: d2zjq11, d2zjq21, d2zjq31, d2zjq41, d2zjqa1, d2zjqa2, d2zjqb1, d2zjqc1, d2zjqd1, d2zjqe1, d2zjqe2, d2zjqf1, d2zjqf2, d2zjqg1, d2zjqh1, d2zjqi1, d2zjqj1, d2zjqk1, d2zjql1, d2zjqm1, d2zjqn1, d2zjqo1, d2zjqp1, d2zjqq1, d2zjqr1, d2zjqs1, d2zjqt1, d2zjqu1, d2zjqv1, d2zjqw1, d2zjqz1
    Representative structure
    protein/RNA complex

Details for d2zjq51

PDB Entry: 2zjq (more details), 3.3 Å

PDB Description: Interaction of L7 with L11 induced by Microccocin binding to the Deinococcus radiodurans 50S subunit
PDB Compounds: (5:) 50S ribosomal protein L7/L12

SCOPe Domain Sequences for d2zjq51:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zjq51 d.45.1.1 (5:52-122) Ribosomal protein L7/12, C-terminal domain {Deinococcus radiodurans [TaxId: 1299]}
eektefdvvlidagaskinvikeirgitglglkeakdmsekggvlkegvakdeaekmkaq
leaagarvelk

SCOPe Domain Coordinates for d2zjq51:

Click to download the PDB-style file with coordinates for d2zjq51.
(The format of our PDB-style files is described here.)

Timeline for d2zjq51: