Lineage for d2zgyb1 (2zgy B:1-157)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2491249Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2491250Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2491251Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)
  6. 2491693Protein Plasmid segregation protein ParM [82438] (1 species)
  7. 2491694Species Escherichia coli [TaxId:562] [82439] (6 PDB entries)
  8. 2491697Domain d2zgyb1: 2zgy B:1-157 [154427]
    automated match to d1mwma1
    complexed with gdp, mg

Details for d2zgyb1

PDB Entry: 2zgy (more details), 1.9 Å

PDB Description: parm with gdp
PDB Compounds: (B:) Plasmid segregation protein parM

SCOPe Domain Sequences for d2zgyb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zgyb1 c.55.1.1 (B:1-157) Plasmid segregation protein ParM {Escherichia coli [TaxId: 562]}
mlvfiddgstniklqwqesdgtikqhispnsfkrewavsfgdkkvfnytlngeqysfdpi
spdavvttniawqysdvnvvavhhalltsglpvsevdivctlplteyydrnnqpntenie
rkkanfrkkitlnggdtftikdvkvmpesipagyevl

SCOPe Domain Coordinates for d2zgyb1:

Click to download the PDB-style file with coordinates for d2zgyb1.
(The format of our PDB-style files is described here.)

Timeline for d2zgyb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2zgyb2