PDB entry 2zgy

View 2zgy on RCSB PDB site
Description: PARM with GDP
Class: structural protein
Keywords: PARM, Plasmid, Plasmid partition, Structural protein
Deposited on 2008-01-30, released 2008-02-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.216
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Plasmid segregation protein parM
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2zgya1, d2zgya2
  • Chain 'B':
    Compound: Plasmid segregation protein parM
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2zgyb1, d2zgyb2
  • Heterogens: MG, GDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2zgyA (A:)
    mlvfiddgstniklqwqesdgtikqhispnsfkrewavsfgdkkvfnytlngeqysfdpi
    spdavvttniawqysdvnvvavhhalltsglpvsevdivctlplteyydrnnqpntenie
    rkkanfrkkitlnggdtftikdvkvmpesipagyevlqeldeldslliidlggttldisq
    vmgklsgiskiygdsslgvslvtsavkdalslartkgssyladdiiihrkdnnylkqrin
    denkisivteamnealrkleqrvlntlnefsgythvmvigggaelicdavkkhtqirder
    ffktnnsqydlvngmylign
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2zgyB (B:)
    mlvfiddgstniklqwqesdgtikqhispnsfkrewavsfgdkkvfnytlngeqysfdpi
    spdavvttniawqysdvnvvavhhalltsglpvsevdivctlplteyydrnnqpntenie
    rkkanfrkkitlnggdtftikdvkvmpesipagyevlqeldeldslliidlggttldisq
    vmgklsgiskiygdsslgvslvtsavkdalslartkgssyladdiiihrkdnnylkqrin
    denkisivteamnealrkleqrvlntlnefsgythvmvigggaelicdavkkhtqirder
    ffktnnsqydlvngmylign