Lineage for d1mwma1 (1mwm A:1-157)
- Root: SCOPe 2.07
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) 
duplication contains two domains of this foldFamily c.55.1.1: Actin/HSP70 [53068] (8 proteins) 
Protein Plasmid segregation protein ParM [82438] (1 species) Species Escherichia coli [TaxId:562] [82439] (6 PDB entries) 
Domain d1mwma1: 1mwm A:1-157 [79580]
complexed with adp, mg
Details for d1mwma1
PDB Entry: 1mwm (more details), 2 Å
PDB Description: parm from plasmid r1 adp form
PDB Compounds: (A:) ParMSCOPe Domain Sequences for d1mwma1:
Sequence, based on SEQRES records: (download)
>d1mwma1 c.55.1.1 (A:1-157) Plasmid segregation protein ParM {Escherichia coli [TaxId: 562]}
mlvfiddgstniklqwqesdgtikqhispnsfkrewavsfgdkkvfnytlngeqysfdpi
spdavvttniawqysdvnvvavhhalltsglpvsevdivctlplteyydrnnqpntenie
rkkanfrkkitlnggdtftikdvkvmpesipagyevl
Sequence, based on observed residues (ATOM records): (download)
>d1mwma1 c.55.1.1 (A:1-157) Plasmid segregation protein ParM {Escherichia coli [TaxId: 562]}
mlvfiddgstniklqwqesdgtikqhispnsfkrewavsfgdkkvfnytlngeqysfdpi
spdtniawqysdvnvvavhhalltsglpvsevdivctlplteyydrnnqpntenierkka
nfrkkitlnggdtftikdvkvmpesipagyevl
SCOPe Domain Coordinates for d1mwma1:
Click to download the PDB-style file with coordinates for d1mwma1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1mwma1:
- d1mwma1 first appeared in SCOP 1.63
- d1mwma1 appears in SCOPe 2.06
- d1mwma1 appears in the current release, SCOPe 2.08
View in 3D
