SCOP 1.75: Domain d2zgyb1: 2zgy B:1-157

Lineage for d2zgyb1 (2zgy B:1-157)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (14 families)
   duplication contains two domains of this fold

5. Family c.55.1.1: Actin/HSP70 [53068] (7 proteins)

6. Protein Plasmid segregation protein ParM [82438] (1 species)

7. Species Escherichia coli [TaxId:562] [82439] (6 PDB entries)

8. Domain d2zgyb1: 2zgy B:1-157 [154427]
   automatically matched to d1mwka1
   complexed with gdp, mg

Details for d2zgyb1

PDB Entry: 2zgy, 1.9 Å

PDB Description: parm with gdp

PDB Compounds: (B:) Plasmid segregation protein parM

SCOP Domain Sequences for d2zgyb1:

Sequence; same for both SEQRES and ATOM records:

>d2zgyb1 c.55.1.1 (B:1-157) Plasmid segregation protein ParM {Escherichia coli [TaxId: 562]}
mlvfiddgstniklqwqesdgtikqhispnsfkrewavsfgdkkvfnytlngeqysfdpi
spdavvttniawqysdvnvvavhhalltsglpvsevdivctlplteyydrnnqpntenie
rkkanfrkkitlnggdtftikdvkvmpesipagyevl

Timeline for d2zgyb1:

• d2zgyb1 is new in SCOP 1.75
  
• d2zgyb1 appears in SCOPe 2.01
  
• d2zgyb1 appears in the current release, SCOPe 2.08