Lineage for d1mwka1 (1mwk A:1-157)
- Root: SCOP 1.75
Class c: Alpha and beta proteins (a/b) [51349] (147 folds) 
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
Superfamily c.55.1: Actin-like ATPase domain [53067] (14 families) 
duplication contains two domains of this foldFamily c.55.1.1: Actin/HSP70 [53068] (7 proteins) 
Protein Plasmid segregation protein ParM [82438] (1 species) Species Escherichia coli [TaxId:562] [82439] (6 PDB entries) 
Domain d1mwka1: 1mwk A:1-157 [79576]
Details for d1mwka1
PDB Entry: 1mwk (more details), 2.3 Å
PDB Description: ParM from plasmid R1 APO form
PDB Compounds: (A:) ParMSCOP Domain Sequences for d1mwka1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mwka1 c.55.1.1 (A:1-157) Plasmid segregation protein ParM {Escherichia coli [TaxId: 562]}
mlvfiddgstniklqwqesdgtikqhispnsfkrewavsfgdkkvfnytlngeqysfdpi
spdavvttniawqysdvnvvavhhalltsglpvsevdivctlplteyydrnnqpntenie
rkkanfrkkitlnggdtftikdvkvmpesipagyevl
SCOP Domain Coordinates for d1mwka1:
Click to download the PDB-style file with coordinates for d1mwka1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1mwka1:
- d1mwka1 first appeared in SCOP 1.63
- d1mwka1 appears in SCOP 1.73
- d1mwka1 appears in SCOPe 2.01
- d1mwka1 appears in the current release, SCOPe 2.08
View in 3D
