SCOPe 2.02: Domain d2vl3a_: 2vl3 A:

Lineage for d2vl3a_ (2vl3 A:)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins)

6. Protein automated matches [190100] (10 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187259] (5 PDB entries)

8. Domain d2vl3a_: 2vl3 A: [153251]
   automated match to d1oc3a_

Details for d2vl3a_

PDB Entry: 2vl3, 1.83 Å

PDB Description: oxidized and reduced forms of human peroxiredoxin 5

PDB Compounds: (A:) peroxiredoxin-5

SCOPe Domain Sequences for d2vl3a_:

Sequence; same for both SEQRES and ATOM records:

>d2vl3a_ c.47.1.10 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sapikvgdaipavevfegepgnkvnlaelfkgkkgvlfgvpgaftpgcskthlpgfveqa
ealkakgvqvvaclsvndafvtgewgrahkaegkvrlladptgafgketdlllddslvsi
fgnrrlkrfsmvvqdgivkalnvepdgtgltcslapniisql

Timeline for d2vl3a_:

• d2vl3a_ first appeared in SCOP 1.75, called d2vl3a1
  
• d2vl3a_ appears in SCOPe 2.01
  
• d2vl3a_ appears in SCOPe 2.03
  
• d2vl3a_ appears in the current release, SCOPe 2.08, called d2vl3a2