| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
| Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins) |
| Protein automated matches [190100] (21 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187259] (21 PDB entries) |
| Domain d2vl3a2: 2vl3 A:1-161 [153251] Other proteins in same PDB: d2vl3a3 automated match to d1oc3a_ |
PDB Entry: 2vl3 (more details), 1.83 Å
SCOPe Domain Sequences for d2vl3a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vl3a2 c.47.1.10 (A:1-161) automated matches {Human (Homo sapiens) [TaxId: 9606]}
apikvgdaipavevfegepgnkvnlaelfkgkkgvlfgvpgaftpgcskthlpgfveqae
alkakgvqvvaclsvndafvtgewgrahkaegkvrlladptgafgketdlllddslvsif
gnrrlkrfsmvvqdgivkalnvepdgtgltcslapniisql
Timeline for d2vl3a2: