Lineage for d2vjxa2 (2vjx A:784-864)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2762430Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) (S)
  5. 2762928Family b.1.4.0: automated matches [254272] (1 protein)
    not a true family
  6. 2762929Protein automated matches [254633] (19 species)
    not a true protein
  7. 2762955Species Bacteroides thetaiotaomicron [TaxId:226186] [255613] (7 PDB entries)
  8. 2762957Domain d2vjxa2: 2vjx A:784-864 [153204]
    Other proteins in same PDB: d2vjxa4, d2vjxa5, d2vjxb4, d2vjxb5, d2vjxb6
    automated match to d2je8a2
    complexed with br, cl, edo, ifl

Details for d2vjxa2

PDB Entry: 2vjx (more details), 1.85 Å

PDB Description: structural and biochemical evidence for a boat-like transition state in beta-mannosidases
PDB Compounds: (A:) beta-mannosidase

SCOPe Domain Sequences for d2vjxa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vjxa2 b.1.4.0 (A:784-864) automated matches {Bacteroides thetaiotaomicron [TaxId: 226186]}
lpptsvsyqmkqtdgkceltlfssmlakdifietplqgarysdnffdllpgerkkviits
prikkgeelpvnikhiretyk

SCOPe Domain Coordinates for d2vjxa2:

Click to download the PDB-style file with coordinates for d2vjxa2.
(The format of our PDB-style files is described here.)

Timeline for d2vjxa2: