Lineage for d2vjxa4 (2vjx A:28-219)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2774100Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2774101Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2774971Family b.18.1.0: automated matches [191481] (1 protein)
    not a true family
  6. 2774972Protein automated matches [190770] (51 species)
    not a true protein
  7. 2775032Species Bacteroides thetaiotaomicron [TaxId:226186] [255611] (7 PDB entries)
  8. 2775033Domain d2vjxa4: 2vjx A:28-219 [153206]
    Other proteins in same PDB: d2vjxa1, d2vjxa2, d2vjxa3, d2vjxa5, d2vjxb1, d2vjxb2, d2vjxb3, d2vjxb5, d2vjxb6
    automated match to d2je8a4
    complexed with br, cl, edo, ifl

Details for d2vjxa4

PDB Entry: 2vjx (more details), 1.85 Å

PDB Description: structural and biochemical evidence for a boat-like transition state in beta-mannosidases
PDB Compounds: (A:) beta-mannosidase

SCOPe Domain Sequences for d2vjxa4:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vjxa4 b.18.1.0 (A:28-219) automated matches {Bacteroides thetaiotaomicron [TaxId: 226186]}
ndtsevmlldtgwefsqsgtekwmpatvpgtvhqdlishellpnpfygmnekkiqwvene
dweyrtsfivseeqlnrdgiqlifegldtyadvylngslllkadnmfvgytlpvksvlrk
genhlyiyfhspirqtlpqyasngfnypadndhhekhlsvfsrkapysygwdwgirmvts
gvwrpvtlrfyd

SCOPe Domain Coordinates for d2vjxa4:

Click to download the PDB-style file with coordinates for d2vjxa4.
(The format of our PDB-style files is described here.)

Timeline for d2vjxa4: