| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) ![]() |
| Family b.1.4.0: automated matches [254272] (1 protein) not a true family |
| Protein automated matches [254633] (19 species) not a true protein |
| Species Bacteroides thetaiotaomicron [TaxId:226186] [255613] (7 PDB entries) |
| Domain d2vjxa3: 2vjx A:679-783 [153205] Other proteins in same PDB: d2vjxa4, d2vjxa5, d2vjxb4, d2vjxb5, d2vjxb6 automated match to d2je8a3 complexed with br, cl, edo, ifl |
PDB Entry: 2vjx (more details), 1.85 Å
SCOPe Domain Sequences for d2vjxa3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vjxa3 b.1.4.0 (A:679-783) automated matches {Bacteroides thetaiotaomicron [TaxId: 226186]}
vlinpiqqndslsvylisdrldtmeqmtlemkvvdfdgktlgkkiqvhslevpantskcv
yrakldgwltpedcrrsflklilkdksghqvaesvhffrktkdlq
Timeline for d2vjxa3: