Lineage for d2vjxa5 (2vjx A:331-678)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829818Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2830557Family c.1.8.3: beta-glycanases [51487] (27 proteins)
    consist of a number of sequence families
  6. 2831217Protein automated matches [190057] (28 species)
    not a true protein
  7. 2831268Species Bacteroides thetaiotaomicron [TaxId:226186] [255614] (7 PDB entries)
  8. 2831269Domain d2vjxa5: 2vjx A:331-678 [153207]
    Other proteins in same PDB: d2vjxa1, d2vjxa2, d2vjxa3, d2vjxa4, d2vjxb1, d2vjxb2, d2vjxb3, d2vjxb4, d2vjxb6
    automated match to d2je8a5
    complexed with br, cl, edo, ifl

Details for d2vjxa5

PDB Entry: 2vjx (more details), 1.85 Å

PDB Description: structural and biochemical evidence for a boat-like transition state in beta-mannosidases
PDB Compounds: (A:) beta-mannosidase

SCOPe Domain Sequences for d2vjxa5:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vjxa5 c.1.8.3 (A:331-678) automated matches {Bacteroides thetaiotaomicron [TaxId: 226186]}
rtirvvnekdkdgesfyfevngipmfakganyipqdallpnvtteryqtlfrdmkeanmn
mvriwgggtyennlfydladengilvwqdfmfactpypsdptflkrveaeavynirrlrn
haslamwcgnneilealkywgfekkftpevyqglmhgydklfrellpstvkefdsdrfyv
hsspylanwgrpeswgtgdshnwgvwygkkpfesldtdlprfmsefgfqsfpemktiaaf
aapedyqiesevmnahqkssignslirtymerdyiipesfedfvyvglvlqgqgmrhgle
ahrrnrpycmgtlywqlndswpvvswssidyygnwkalhyqakrafap

SCOPe Domain Coordinates for d2vjxa5:

Click to download the PDB-style file with coordinates for d2vjxa5.
(The format of our PDB-style files is described here.)

Timeline for d2vjxa5: