SCOPe 2.05: Domain d2vhpf1: 2vhp F:1-100

Lineage for d2vhpf1 (2vhp F:1-100)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.14: Ribosomal protein S6 [54995] (1 family)

5. Family d.58.14.1: Ribosomal protein S6 [54996] (1 protein)

6. Protein Ribosomal protein S6 [54997] (4 species)

7. Species Escherichia coli [TaxId:562] [160317] (24 PDB entries)
   Uniprot P02358 1-100

8. Domain d2vhpf1: 2vhp F:1-100 [153150]
   Other proteins in same PDB: d2vhpb1, d2vhpc1, d2vhpc2, d2vhpd1, d2vhpe1, d2vhpe2, d2vhpg1, d2vhph1, d2vhpi1, d2vhpj1, d2vhpk1, d2vhpl1, d2vhpm1, d2vhpn1, d2vhpo1, d2vhpp1, d2vhpq1, d2vhpr1, d2vhps1, d2vhpt1, d2vhpu1
   protein/RNA complex; complexed with mg
   protein/RNA complex; complexed with mg

Details for d2vhpf1

PDB Entry: 2vhp, 3.74 Å

PDB Description: Structure of PDF binding helix in complex with the ribosome (part 4 of 4)

PDB Compounds: (F:) 30S ribosomal protein S6

SCOPe Domain Sequences for d2vhpf1:

Sequence; same for both SEQRES and ATOM records:

>d2vhpf1 d.58.14.1 (F:1-100) Ribosomal protein S6 {Escherichia coli [TaxId: 562]}
mrhyeivfmvhpdqseqvpgmierytaaitgaegkihrledwgrrqlaypinklhkahyv
lmnveapqevidelettfrfndavirsmvmrtkhavteas

Timeline for d2vhpf1:

• d2vhpf1 first appeared in SCOP 1.75
  
• d2vhpf1 appears in SCOPe 2.04
  
• d2vhpf1 appears in SCOPe 2.06
  
• d2vhpf1 appears in the current release, SCOPe 2.08