SCOPe 2.05: Domain d2vhpk1: 2vhp K:12-128

Lineage for d2vhpk1 (2vhp K:12-128)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.4: Translational machinery components [53137] (3 families)

5. Family c.55.4.1: Ribosomal protein L18 and S11 [53138] (2 proteins)

6. Protein Ribosomal protein S11 [53141] (2 species)

7. Species Escherichia coli [TaxId:562] [159644] (24 PDB entries)
   Uniprot P0A7R9 12-128

8. Domain d2vhpk1: 2vhp K:12-128 [153155]
   Other proteins in same PDB: d2vhpb1, d2vhpc1, d2vhpc2, d2vhpd1, d2vhpe1, d2vhpe2, d2vhpf1, d2vhpg1, d2vhph1, d2vhpi1, d2vhpj1, d2vhpl1, d2vhpm1, d2vhpn1, d2vhpo1, d2vhpp1, d2vhpq1, d2vhpr1, d2vhps1, d2vhpt1, d2vhpu1
   protein/RNA complex; complexed with mg
   protein/RNA complex; complexed with mg

Details for d2vhpk1

PDB Entry: 2vhp, 3.74 Å

PDB Description: Structure of PDF binding helix in complex with the ribosome (part 4 of 4)

PDB Compounds: (K:) 30S ribosomal protein S11

SCOPe Domain Sequences for d2vhpk1:

Sequence; same for both SEQRES and ATOM records:

>d2vhpk1 c.55.4.1 (K:12-128) Ribosomal protein S11 {Escherichia coli [TaxId: 562]}
rkqvsdgvahihasfnntivtitdrqgnalgwataggsgfrgsrkstpfaaqvaaercad
avkeygiknlevmvkgpgpgrestiralnaagfritnitdvtpiphngcrppkkrrv

Timeline for d2vhpk1:

• d2vhpk1 first appeared in SCOP 1.75
  
• d2vhpk1 appears in SCOPe 2.04
  
• d2vhpk1 appears in SCOPe 2.06
  
• d2vhpk1 appears in the current release, SCOPe 2.08