![]() | Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.15: Ribosomal protein S10 [54999] (1 family) ![]() automatically mapped to Pfam PF00338 |
![]() | Family d.58.15.1: Ribosomal protein S10 [55000] (1 protein) |
![]() | Protein Ribosomal protein S10 [55001] (2 species) |
![]() | Species Escherichia coli [TaxId:562] [160319] (24 PDB entries) Uniprot P0A7R5 5-102 |
![]() | Domain d2vhpj1: 2vhp J:5-102 [153154] Other proteins in same PDB: d2vhpb1, d2vhpc1, d2vhpc2, d2vhpd1, d2vhpe1, d2vhpe2, d2vhpf1, d2vhpg1, d2vhph1, d2vhpi1, d2vhpk1, d2vhpl1, d2vhpm1, d2vhpn1, d2vhpo1, d2vhpp1, d2vhpq1, d2vhpr1, d2vhps1, d2vhpt1, d2vhpu1 protein/RNA complex; complexed with mg protein/RNA complex; complexed with mg |
PDB Entry: 2vhp (more details), 3.74 Å
SCOPe Domain Sequences for d2vhpj1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vhpj1 d.58.15.1 (J:5-102) Ribosomal protein S10 {Escherichia coli [TaxId: 562]} ririrlkafdhrlidqataeivetakrtgaqvrgpiplptrkerftvlisphvnkdardq yeirthlrlvdiveptektvdalmrldlaagvdvqisl
Timeline for d2vhpj1: