Lineage for d2vhpj1 (2vhp J:5-102)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1906287Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1909920Superfamily d.58.15: Ribosomal protein S10 [54999] (1 family) (S)
    automatically mapped to Pfam PF00338
  5. 1909921Family d.58.15.1: Ribosomal protein S10 [55000] (1 protein)
  6. 1909922Protein Ribosomal protein S10 [55001] (2 species)
  7. 1909923Species Escherichia coli [TaxId:562] [160319] (24 PDB entries)
    Uniprot P0A7R5 5-102
  8. 1909941Domain d2vhpj1: 2vhp J:5-102 [153154]
    Other proteins in same PDB: d2vhpb1, d2vhpc1, d2vhpc2, d2vhpd1, d2vhpe1, d2vhpe2, d2vhpf1, d2vhpg1, d2vhph1, d2vhpi1, d2vhpk1, d2vhpl1, d2vhpm1, d2vhpn1, d2vhpo1, d2vhpp1, d2vhpq1, d2vhpr1, d2vhps1, d2vhpt1, d2vhpu1
    protein/RNA complex; complexed with mg
    protein/RNA complex; complexed with mg

Details for d2vhpj1

PDB Entry: 2vhp (more details), 3.74 Å

PDB Description: Structure of PDF binding helix in complex with the ribosome (part 4 of 4)
PDB Compounds: (J:) 30S ribosomal protein S10

SCOPe Domain Sequences for d2vhpj1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vhpj1 d.58.15.1 (J:5-102) Ribosomal protein S10 {Escherichia coli [TaxId: 562]}
ririrlkafdhrlidqataeivetakrtgaqvrgpiplptrkerftvlisphvnkdardq
yeirthlrlvdiveptektvdalmrldlaagvdvqisl

SCOPe Domain Coordinates for d2vhpj1:

Click to download the PDB-style file with coordinates for d2vhpj1.
(The format of our PDB-style files is described here.)

Timeline for d2vhpj1: