SCOPe 2.05: Domain d2vhpc1: 2vhp C:1-105

Lineage for d2vhpc1 (2vhp C:1-105)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.52: Alpha-lytic protease prodomain-like [54805] (10 superfamilies)
   core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta

4. Superfamily d.52.3: Prokaryotic type KH domain (KH-domain type II) [54814] (1 family)
   Prokaryotic and eukaryotic domains share a KH-motif but have different topologies

5. Family d.52.3.1: Prokaryotic type KH domain (KH-domain type II) [54815] (4 proteins)

6. Protein Ribosomal protein S3 N-terminal domain [54816] (4 species)

7. Species Escherichia coli [TaxId:562] [160236] (24 PDB entries)
   Uniprot P0A7V3 1-105

8. Domain d2vhpc1: 2vhp C:1-105 [153145]
   Other proteins in same PDB: d2vhpb1, d2vhpc2, d2vhpd1, d2vhpe1, d2vhpe2, d2vhpf1, d2vhpg1, d2vhph1, d2vhpi1, d2vhpj1, d2vhpk1, d2vhpl1, d2vhpm1, d2vhpn1, d2vhpo1, d2vhpp1, d2vhpq1, d2vhpr1, d2vhps1, d2vhpt1, d2vhpu1
   protein/RNA complex; complexed with mg
   protein/RNA complex; complexed with mg

Details for d2vhpc1

PDB Entry: 2vhp, 3.74 Å

PDB Description: Structure of PDF binding helix in complex with the ribosome (part 4 of 4)

PDB Compounds: (C:) 30S ribosomal protein S3

SCOPe Domain Sequences for d2vhpc1:

Sequence; same for both SEQRES and ATOM records:

>d2vhpc1 d.52.3.1 (C:1-105) Ribosomal protein S3 N-terminal domain {Escherichia coli [TaxId: 562]}
gqkvhpngirlgivkpwnstwfantkefadnldsdfkvrqyltkelakasvsrivierpa
ksirvtihtarpgivigkkgedveklrkvvadiagvpaqiniaev

Timeline for d2vhpc1:

• d2vhpc1 first appeared in SCOP 1.75
  
• d2vhpc1 appears in SCOPe 2.04
  
• d2vhpc1 appears in SCOPe 2.06
  
• d2vhpc1 appears in the current release, SCOPe 2.08