Lineage for d2vhpo1 (2vhp O:1-88)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1725387Fold a.16: S15/NS1 RNA-binding domain [47059] (1 superfamily)
    3 helices; irregular array
  4. 1725388Superfamily a.16.1: S15/NS1 RNA-binding domain [47060] (3 families) (S)
  5. 1725434Family a.16.1.2: Ribosomal protein S15 [47064] (1 protein)
    contains additional N-terminal helix that forms a separate unit
    automatically mapped to Pfam PF00312
  6. 1725435Protein Ribosomal protein S15 [47065] (3 species)
  7. 1725438Species Escherichia coli [TaxId:562] [158383] (10 PDB entries)
    Uniprot Q8X9M2 2-89
  8. 1725448Domain d2vhpo1: 2vhp O:1-88 [153159]
    Other proteins in same PDB: d2vhpb1, d2vhpc1, d2vhpc2, d2vhpd1, d2vhpe1, d2vhpe2, d2vhpf1, d2vhpg1, d2vhph1, d2vhpi1, d2vhpj1, d2vhpk1, d2vhpl1, d2vhpm1, d2vhpn1, d2vhpp1, d2vhpq1, d2vhpr1, d2vhps1, d2vhpt1, d2vhpu1
    protein/RNA complex; complexed with mg
    protein/RNA complex; complexed with mg

Details for d2vhpo1

PDB Entry: 2vhp (more details), 3.74 Å

PDB Description: Structure of PDF binding helix in complex with the ribosome (part 4 of 4)
PDB Compounds: (O:) 30S ribosomal protein S15

SCOPe Domain Sequences for d2vhpo1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vhpo1 a.16.1.2 (O:1-88) Ribosomal protein S15 {Escherichia coli [TaxId: 562]}
slsteatakivsefgrdandtgstevqvalltaqinhlqghfaehkkdhhsrrgllrmvs
qrrklldylkrkdvarytrlierlglrr

SCOPe Domain Coordinates for d2vhpo1:

Click to download the PDB-style file with coordinates for d2vhpo1.
(The format of our PDB-style files is described here.)

Timeline for d2vhpo1: