Lineage for d2vglb_ (2vgl B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006336Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2006337Superfamily a.118.1: ARM repeat [48371] (26 families) (S)
  5. 2006697Family a.118.1.10: Clathrin adaptor core protein [74771] (3 protein domains)
    automatically mapped to Pfam PF01602
  6. 2006701Protein Adaptin beta subunit N-terminal fragment [74774] (1 species)
  7. 2006702Species Human (Homo sapiens) [TaxId:9606] [74775] (1 PDB entry)
  8. 2006703Domain d2vglb_: 2vgl B: [153035]
    Other proteins in same PDB: d2vgla_, d2vglm1, d2vgls_
    complexed with ihp

Details for d2vglb_

PDB Entry: 2vgl (more details), 2.59 Å

PDB Description: ap2 clathrin adaptor core
PDB Compounds: (B:) AP-2 complex subunit beta-1

SCOPe Domain Sequences for d2vglb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vglb_ a.118.1.10 (B:) Adaptin beta subunit N-terminal fragment {Human (Homo sapiens) [TaxId: 9606]}
skyfttnkkgeifelkaelnnekkekrkeavkkviaamtvgkdvsslfpdvvncmqtdnl
elkklvylylmnyaksqpdmaimavnsfvkdcedpnpliralavrtmgcirvdkiteylc
eplrkclkdedpyvrktaavcvaklhdinaqmvedqgfldslrdliadsnpmvvanavaa
lseiseshpnsnlldlnpqninklltalnectewgqifildclsnynpkddreaqsicer
vtprlshansavvlsavkvlmkflellpkdsdyynmllkklapplvtllsgepevqyval
rninlivqkrpeilkqeikvffvkyndpiyvklekldimirlasqaniaqvlaelkeyat
evdvdfvrkavraigrcaikveqsaercvstlldliqtkvnyvvqeaivvirdifrkypn
kyesiiatlcenldsldepdaraamiwivgeyaeridnadellesflegfhdestqvqlt
lltaivklflkkpsetqelvqqvlslatqdsdnpdlrdrgyiywrllstdpvtakevvls
ekpliseetdlieptlldelichigslasvyhkppnafv

SCOPe Domain Coordinates for d2vglb_:

Click to download the PDB-style file with coordinates for d2vglb_.
(The format of our PDB-style files is described here.)

Timeline for d2vglb_: