Lineage for d2vgla_ (2vgl A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006336Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2006337Superfamily a.118.1: ARM repeat [48371] (26 families) (S)
  5. 2006697Family a.118.1.10: Clathrin adaptor core protein [74771] (3 protein domains)
    automatically mapped to Pfam PF01602
  6. 2006698Protein Adaptin alpha C subunit N-terminal fragment [74772] (1 species)
  7. 2006699Species Mouse (Mus musculus) [TaxId:10090] [74773] (1 PDB entry)
  8. 2006700Domain d2vgla_: 2vgl A: [161577]
    Other proteins in same PDB: d2vglb_, d2vglm1, d2vgls_
    complexed with ihp

Details for d2vgla_

PDB Entry: 2vgl (more details), 2.59 Å

PDB Description: ap2 clathrin adaptor core
PDB Compounds: (A:) adaptor protein complex ap-2, alpha 2 subunit

SCOPe Domain Sequences for d2vgla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vgla_ a.118.1.10 (A:) Adaptin alpha C subunit N-terminal fragment {Mouse (Mus musculus) [TaxId: 10090]}
gmrglavfisdirnckskeaeikrinkelanirskfkgdkaldgyskkkyvckllfifll
ghdidfghmeavnllssnrytekqigylfisvlvnsnselirlinnaikndlasrnptfm
glalhcianvgsremaeafageipkilvagdtmdsvkqsaalcllrlyrtspdlvpmgdw
tsrvvhllndqhlgvvtaatslittlaqknpeefktsvslavsrlsrivtsastdlqdyt
yyfvpapwlsvkllrllqcypppedpavrgrltecletilnkaqeppkskkvqhsnakna
vlfeaisliihhdsepnllvracnqlgqflqhretnlrylalesmctlassefsheavkt
hietvinalkterdvsvrqravdllyamcdrsnaqqivaemlsyletadysireeivlkv
ailaekyavdytwyvdtilnliriagdyvseevwyrviqivinrddvqgyaaktvfealq
apachenlvkvggyilgefgnliagdprsspliqfnllhskfhlcsvptralllstyikf
vnlfpevkatiqdvlrsdsqlknadvelqqraveylrlstvastdilatvleemppfper

SCOPe Domain Coordinates for d2vgla_:

Click to download the PDB-style file with coordinates for d2vgla_.
(The format of our PDB-style files is described here.)

Timeline for d2vgla_: