Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.110: Profilin-like [55769] (10 superfamilies) core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha |
Superfamily d.110.4: SNARE-like [64356] (5 families) beta(2)-alpha-beta(3)-alpha(2) |
Family d.110.4.2: Clathrin coat assembly domain [75521] (3 proteins) automatically mapped to Pfam PF01217 |
Protein Mu2 adaptin (clathrin coat assembly protein AP50) [75522] (1 species) |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [75523] (1 PDB entry) |
Domain d2vglm1: 2vgl M:1-141 [161578] Other proteins in same PDB: d2vgla_, d2vglb_, d2vgls_ complexed with ihp |
PDB Entry: 2vgl (more details), 2.6 Å
SCOPe Domain Sequences for d2vglm1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vglm1 d.110.4.2 (M:1-141) Mu2 adaptin (clathrin coat assembly protein AP50) {Norway rat (Rattus norvegicus) [TaxId: 10116]} migglfiynhkgevlisrvyrddigrnavdafrvnviharqqvrspvtniartsffhvkr sniwlaavtkqnvnaamvfeflykmcdvmaayfgkiseeniknnfvliyelldeildfgy pqnsetgalktfitqqgiksq
Timeline for d2vglm1: