Lineage for d2ve8c_ (2ve8 C:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2304501Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2305606Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2306979Family a.4.5.67: FtsK C-terminal domain-like [140295] (2 proteins)
    PfamB PB000224
    automatically mapped to Pfam PF09397
  6. 2306985Protein automated matches [190361] (1 species)
    not a true protein
  7. 2306986Species Pseudomonas aeruginosa [TaxId:287] [187192] (2 PDB entries)
  8. 2306989Domain d2ve8c_: 2ve8 C: [153010]
    automated match to d2j5oa1

Details for d2ve8c_

PDB Entry: 2ve8 (more details), 1.4 Å

PDB Description: Xray structure of FtsK gamma domain (P. aeruginosa)
PDB Compounds: (C:) DNA translocase ftsk

SCOPe Domain Sequences for d2ve8c_:

Sequence, based on SEQRES records: (download)

>d2ve8c_ a.4.5.67 (C:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
ddplydeavrfvtesrrasisavqrklkigynraarmieamemagvvtpmntngsrevia
papvr

Sequence, based on observed residues (ATOM records): (download)

>d2ve8c_ a.4.5.67 (C:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
ddplydeavrfvtesrrasisavqrklkigynraarmieamemagvvtpmngsreviapa
pvr

SCOPe Domain Coordinates for d2ve8c_:

Click to download the PDB-style file with coordinates for d2ve8c_.
(The format of our PDB-style files is described here.)

Timeline for d2ve8c_: