Lineage for d2ve8a_ (2ve8 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2694366Family a.4.5.67: FtsK C-terminal domain-like [140295] (2 proteins)
    PfamB PB000224
    automatically mapped to Pfam PF09397
  6. 2694372Protein automated matches [190361] (1 species)
    not a true protein
  7. 2694373Species Pseudomonas aeruginosa [TaxId:287] [187192] (2 PDB entries)
  8. 2694374Domain d2ve8a_: 2ve8 A: [153008]
    automated match to d2j5oa1

Details for d2ve8a_

PDB Entry: 2ve8 (more details), 1.4 Å

PDB Description: Xray structure of FtsK gamma domain (P. aeruginosa)
PDB Compounds: (A:) DNA translocase ftsk

SCOPe Domain Sequences for d2ve8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ve8a_ a.4.5.67 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
eddplydeavrfvtesrrasisavqrklkigynraarmieamemagvvtpmntngsrevi
apapvrd

SCOPe Domain Coordinates for d2ve8a_:

Click to download the PDB-style file with coordinates for d2ve8a_.
(The format of our PDB-style files is described here.)

Timeline for d2ve8a_: