PDB entry 2ve8

View 2ve8 on RCSB PDB site
Description: Xray structure of FtsK gamma domain (P. aeruginosa)
Class: transport protein
Keywords: nucleotide-binding, chromosome partition, ATP-binding, DNA-binding, translocase, winged helix, bacterial cell division, transport protein, cell division, transmembrane, inner membrane, ftsz, ftsk, membrane, cell cycle, DNA binding
Deposited on 2007-10-17, released 2008-09-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-01-25, with a file datestamp of 2012-01-20.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.146
AEROSPACI score: 0.74 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA translocase ftsk
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ve8a_
  • Chain 'B':
    Compound: DNA translocase ftsk
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ve8b_
  • Chain 'C':
    Compound: DNA translocase ftsk
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ve8c_
  • Chain 'D':
    Compound: DNA translocase ftsk
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ve8d_
  • Chain 'E':
    Compound: DNA translocase ftsk
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ve8e_
  • Chain 'F':
    Compound: DNA translocase ftsk
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ve8f_
  • Chain 'G':
    Compound: DNA translocase ftsk
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ve8g_
  • Chain 'H':
    Compound: DNA translocase ftsk
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ve8h_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ve8A (A:)
    gsgegseddplydeavrfvtesrrasisavqrklkigynraarmieamemagvvtpmntn
    gsreviapapvrd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ve8A (A:)
    eddplydeavrfvtesrrasisavqrklkigynraarmieamemagvvtpmntngsrevi
    apapvrd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ve8B (B:)
    gsgegseddplydeavrfvtesrrasisavqrklkigynraarmieamemagvvtpmntn
    gsreviapapvrd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ve8B (B:)
    eddplydeavrfvtesrrasisavqrklkigynraarmieamemagvvtpmntngsrevi
    apapv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2ve8C (C:)
    gsgegseddplydeavrfvtesrrasisavqrklkigynraarmieamemagvvtpmntn
    gsreviapapvrd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ve8C (C:)
    ddplydeavrfvtesrrasisavqrklkigynraarmieamemagvvtpmngsreviapa
    pvr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2ve8D (D:)
    gsgegseddplydeavrfvtesrrasisavqrklkigynraarmieamemagvvtpmntn
    gsreviapapvrd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ve8D (D:)
    seddplydeavrfvtesrrasisavqrklkigynraarmieamemagvvtpmntngsrev
    iapapvrd
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2ve8E (E:)
    gsgegseddplydeavrfvtesrrasisavqrklkigynraarmieamemagvvtpmntn
    gsreviapapvrd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ve8E (E:)
    seddplydeavrfvtesrrasisavqrklkigynraarmieamemagvvtpmntngsrev
    iapapvr
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2ve8F (F:)
    gsgegseddplydeavrfvtesrrasisavqrklkigynraarmieamemagvvtpmntn
    gsreviapapvrd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ve8F (F:)
    seddplydeavrfvtesrrasisavqrklkigynraarmieamemagvvtpmntngsrev
    iapapv
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2ve8G (G:)
    gsgegseddplydeavrfvtesrrasisavqrklkigynraarmieamemagvvtpmntn
    gsreviapapvrd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ve8G (G:)
    dplydeavrfvtesrrasisavqrklkigynraarmieamemagvvtpmntngsreviap
    a
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2ve8H (H:)
    gsgegseddplydeavrfvtesrrasisavqrklkigynraarmieamemagvvtpmntn
    gsreviapapvrd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ve8H (H:)
    dplydeavrfvtesrrasisavqrklkigynraarmieamemagvvtpmntngsreviap
    apv