| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (2 families) ![]() this domains follows the thioredoxin-like N-terminal domain |
| Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (18 proteins) |
| Protein Class sigma GST [81351] (5 species) |
| Species Human (Homo sapiens) [TaxId:9606] [89061] (11 PDB entries) Uniprot O60760; synonym: hematopoietic prostaglandin D synthase |
| Domain d2vcza1: 2vcz A:76-199 [152946] Other proteins in same PDB: d2vcza2, d2vczb2, d2vczc2, d2vczd2 automatically matched to d1iyha1 complexed with gsh, vc3 |
PDB Entry: 2vcz (more details), 1.95 Å
SCOPe Domain Sequences for d2vcza1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vcza1 a.45.1.1 (A:76-199) Class sigma GST {Human (Homo sapiens) [TaxId: 9606]}
dlagntemeqchvdaivdtlddfmscfpwaekkqdvkeqmfnelltynaphlmqdldtyl
ggrewlignsvtwadfyweicsttllvfkpdlldnhprlvtlrkkvqaipavanwikrrp
qtkl
Timeline for d2vcza1: