|  | Class a: All alpha proteins [46456] (284 folds) | 
|  | Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix | 
|  | Superfamily a.45.1: GST C-terminal domain-like [47616] (2 families)  this domains follows the thioredoxin-like N-terminal domain | 
|  | Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (18 proteins) | 
|  | Protein Class sigma GST [81351] (5 species) | 
|  | Species Human (Homo sapiens) [TaxId:9606] [89061] (11 PDB entries) Uniprot O60760; synonym: hematopoietic prostaglandin D synthase | 
|  | Domain d2vczc1: 2vcz C:76-199 [152950] Other proteins in same PDB: d2vcza2, d2vczb2, d2vczc2, d2vczd2 automatically matched to d1iyha1 complexed with gsh, vc3 | 
PDB Entry: 2vcz (more details), 1.95 Å
SCOPe Domain Sequences for d2vczc1:
Sequence, based on SEQRES records: (download)
>d2vczc1 a.45.1.1 (C:76-199) Class sigma GST {Human (Homo sapiens) [TaxId: 9606]}
dlagntemeqchvdaivdtlddfmscfpwaekkqdvkeqmfnelltynaphlmqdldtyl
ggrewlignsvtwadfyweicsttllvfkpdlldnhprlvtlrkkvqaipavanwikrrp
qtkl
>d2vczc1 a.45.1.1 (C:76-199) Class sigma GST {Human (Homo sapiens) [TaxId: 9606]}
dlagntemeqchvdaivdtlddfmtynaphlmqdldtylggrewlignsvtwadfyweic
sttllvfkpdlldnhprlvtlrkkvqaipavanwikrrpqtkl
Timeline for d2vczc1: