Lineage for d2vcza1 (2vcz A:76-199)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2712830Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2712831Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2712832Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)
  6. 2713549Protein automated matches [226848] (14 species)
    not a true protein
  7. 2713569Species Human (Homo sapiens) [TaxId:9606] [224956] (38 PDB entries)
  8. 2713588Domain d2vcza1: 2vcz A:76-199 [152946]
    Other proteins in same PDB: d2vcza2, d2vczb2, d2vczc2, d2vczd2
    automated match to d1pd211
    complexed with gsh, vc3

Details for d2vcza1

PDB Entry: 2vcz (more details), 1.95 Å

PDB Description: complex structure of prostaglandin d2 synthase at 1.95a.
PDB Compounds: (A:) glutathione-requiring prostaglandin d synthase

SCOPe Domain Sequences for d2vcza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vcza1 a.45.1.1 (A:76-199) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlagntemeqchvdaivdtlddfmscfpwaekkqdvkeqmfnelltynaphlmqdldtyl
ggrewlignsvtwadfyweicsttllvfkpdlldnhprlvtlrkkvqaipavanwikrrp
qtkl

SCOPe Domain Coordinates for d2vcza1:

Click to download the PDB-style file with coordinates for d2vcza1.
(The format of our PDB-style files is described here.)

Timeline for d2vcza1: