Lineage for d1binb_ (1bin B:)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.1: Globin-like [46457] (2 superfamilies) Superfamily a.1.1: Globin-like [46458] (3 families) 
Family a.1.1.2: Globins [46463] (16 proteins) 
Protein Leghemoglobin [46481] (2 species) 
Species Soybean (Glycine max), isoform A [TaxId:3847] [46483] (2 PDB entries) 
Domain d1binb_: 1bin B: [15232]
Details for d1binb_
PDB Entry: 1bin (more details), 2.2 Å
PDB Description: leghemoglobin a (acetomet)
SCOP Domain Sequences for d1binb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1binb_ a.1.1.2 (B:) Leghemoglobin {Soybean (Glycine max), isoform A}
vaftekqdalvsssfeafkanipqysvvfytsilekapaakdlfsflangvdptnpkltg
haeklfalvrdsagqlkasgtvvadaalgsvhaqkavtdpqfvvvkeallktikaavgdk
wsdelsrawevaydelaaaikka
SCOP Domain Coordinates for d1binb_:
Click to download the PDB-style file with coordinates for d1binb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1binb_:
- d1binb_ appears in SCOP 1.57
- d1binb_ appears in the current release, SCOPe 2.08
View in 3D
