![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
![]() | Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
![]() | Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
![]() | Protein Leghemoglobin [46481] (2 species) |
![]() | Species Soybean (Glycine max), isoform A [TaxId:3847] [46483] (2 PDB entries) |
![]() | Domain d1binb_: 1bin B: [15232] complexed with act, hem, so4 |
PDB Entry: 1bin (more details), 2.2 Å
SCOPe Domain Sequences for d1binb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1binb_ a.1.1.2 (B:) Leghemoglobin {Soybean (Glycine max), isoform A [TaxId: 3847]} vaftekqdalvsssfeafkanipqysvvfytsilekapaakdlfsflangvdptnpkltg haeklfalvrdsagqlkasgtvvadaalgsvhaqkavtdpqfvvvkeallktikaavgdk wsdelsrawevaydelaaaikka
Timeline for d1binb_: