Lineage for d2uxbr1 (2uxb R:19-88)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2695537Superfamily a.4.8: Ribosomal protein S18 [46911] (1 family) (S)
  5. 2695538Family a.4.8.1: Ribosomal protein S18 [46912] (1 protein)
  6. 2695539Protein Ribosomal protein S18 [46913] (2 species)
  7. 2695565Species Thermus thermophilus [TaxId:274] [46914] (47 PDB entries)
    Uniprot P80382
  8. 2695588Domain d2uxbr1: 2uxb R:19-88 [152279]
    Other proteins in same PDB: d2uxbb1, d2uxbd1, d2uxbe1, d2uxbf1, d2uxbg1, d2uxbh1, d2uxbi1, d2uxbj1, d2uxbk1, d2uxbl1, d2uxbm1, d2uxbn1, d2uxbo1, d2uxbp1, d2uxbq1, d2uxbs1, d2uxbt1, d2uxbu1
    automatically matched to d2j00r1
    protein/RNA complex; complexed with k, mg, par, zn

Details for d2uxbr1

PDB Entry: 2uxb (more details), 3.1 Å

PDB Description: crystal structure of an extended trna anticodon stem loop in complex with its cognate mrna gggu in the context of the thermus thermophilus 30s subunit.
PDB Compounds: (R:) ribosomal protein s18

SCOPe Domain Sequences for d2uxbr1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2uxbr1 a.4.8.1 (R:19-88) Ribosomal protein S18 {Thermus thermophilus [TaxId: 274]}
kakvkatlgefdlrdyrnvevlkrflsetgkilprrrtglsakeqrilaktikrarilgl
lpfteklvrk

SCOPe Domain Coordinates for d2uxbr1:

Click to download the PDB-style file with coordinates for d2uxbr1.
(The format of our PDB-style files is described here.)

Timeline for d2uxbr1: