Lineage for d2uxbq1 (2uxb Q:2-105)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787872Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2789270Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. 2789672Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (36 proteins)
    barrel, closed; n=5, S=8
  6. 2790014Protein Ribosomal protein S17 [50304] (3 species)
  7. 2790044Species Thermus thermophilus [TaxId:274] [50305] (45 PDB entries)
    Uniprot P24321
  8. 2790067Domain d2uxbq1: 2uxb Q:2-105 [152278]
    Other proteins in same PDB: d2uxbb1, d2uxbd1, d2uxbe1, d2uxbf1, d2uxbg1, d2uxbh1, d2uxbi1, d2uxbj1, d2uxbk1, d2uxbl1, d2uxbm1, d2uxbn1, d2uxbo1, d2uxbp1, d2uxbr1, d2uxbs1, d2uxbt1, d2uxbu1
    automatically matched to d1fjgq_
    protein/RNA complex; complexed with k, mg, par, zn
    has additional insertions and/or extensions that are not grouped together

Details for d2uxbq1

PDB Entry: 2uxb (more details), 3.1 Å

PDB Description: crystal structure of an extended trna anticodon stem loop in complex with its cognate mrna gggu in the context of the thermus thermophilus 30s subunit.
PDB Compounds: (Q:) ribosomal protein s17

SCOPe Domain Sequences for d2uxbq1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2uxbq1 b.40.4.5 (Q:2-105) Ribosomal protein S17 {Thermus thermophilus [TaxId: 274]}
pkkvltgvvvsdkmqktvtvlverqfphplygkvikrskkylahdpeekyklgdvveiie
srpiskrkrfrvlrlvesgrmdlvekylirrqnyqslskrggka

SCOPe Domain Coordinates for d2uxbq1:

Click to download the PDB-style file with coordinates for d2uxbq1.
(The format of our PDB-style files is described here.)

Timeline for d2uxbq1: