Lineage for d2uupa2 (2uup A:298-440)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1610448Fold c.59: MurD-like peptide ligases, peptide-binding domain [53243] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 6 strands, order 126345; strand 1 is antiparallel to the rest
  4. 1610449Superfamily c.59.1: MurD-like peptide ligases, peptide-binding domain [53244] (3 families) (S)
  5. 1610491Family c.59.1.0: automated matches [254241] (1 protein)
    not a true family
  6. 1610492Protein automated matches [254550] (3 species)
    not a true protein
  7. 1610493Species Escherichia coli [TaxId:562] [255259] (8 PDB entries)
  8. 1610497Domain d2uupa2: 2uup A:298-440 [152201]
    Other proteins in same PDB: d2uupa1, d2uupa3
    automated match to d4uaga2
    complexed with lk4, so4

Details for d2uupa2

PDB Entry: 2uup (more details), 1.88 Å

PDB Description: crystal structure of murd ligase in complex with d-glu containing sulfonamide inhibitor
PDB Compounds: (A:) udp-n-acetylmuramoylalanine--d-glutamate ligase

SCOPe Domain Sequences for d2uupa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2uupa2 c.59.1.0 (A:298-440) automated matches {Escherichia coli [TaxId: 562]}
glphrfevvlehngvrwindskatnvgsteaalnglhvdgtlhlllggdgksadfsplar
ylngdnvrlycfgrdgaqlaalrpevaeqtetmeqamrllaprvqpgdmvllspacasld
qfknfeqrgnefarlakelgshh

SCOPe Domain Coordinates for d2uupa2:

Click to download the PDB-style file with coordinates for d2uupa2.
(The format of our PDB-style files is described here.)

Timeline for d2uupa2: