SCOPe 2.03: Domain d2uupa2: 2uup A:298-437

Lineage for d2uupa2 (2uup A:298-437)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.59: MurD-like peptide ligases, peptide-binding domain [53243] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 6 strands, order 126345; strand 1 is antiparallel to the rest

4. Superfamily c.59.1: MurD-like peptide ligases, peptide-binding domain [53244] (2 families)

5. Family c.59.1.1: MurCDEF C-terminal domain [53245] (4 proteins)

6. Protein UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD [53246] (1 species)

7. Species Escherichia coli [TaxId:562] [53247] (11 PDB entries)

8. Domain d2uupa2: 2uup A:298-437 [152201]
   Other proteins in same PDB: d2uupa1, d2uupa3
   automatically matched to d1e0da2
   complexed with lk4, so4

Details for d2uupa2

PDB Entry: 2uup, 1.88 Å

PDB Description: crystal structure of murd ligase in complex with d-glu containing sulfonamide inhibitor

PDB Compounds: (A:) udp-n-acetylmuramoylalanine--d-glutamate ligase

SCOPe Domain Sequences for d2uupa2:

Sequence; same for both SEQRES and ATOM records:

>d2uupa2 c.59.1.1 (A:298-437) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]}
glphrfevvlehngvrwindskatnvgsteaalnglhvdgtlhlllggdgksadfsplar
ylngdnvrlycfgrdgaqlaalrpevaeqtetmeqamrllaprvqpgdmvllspacasld
qfknfeqrgnefarlakelg

Timeline for d2uupa2:

• d2uupa2 first appeared in SCOP 1.75
  
• d2uupa2 appears in SCOPe 2.02
  
• d2uupa2 appears in SCOPe 2.04
  
• d2uupa2 appears in the current release, SCOPe 2.08