Lineage for d4uaga2 (4uag A:298-437)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1610448Fold c.59: MurD-like peptide ligases, peptide-binding domain [53243] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 6 strands, order 126345; strand 1 is antiparallel to the rest
  4. 1610449Superfamily c.59.1: MurD-like peptide ligases, peptide-binding domain [53244] (3 families) (S)
  5. 1610450Family c.59.1.1: MurCDEF C-terminal domain [53245] (4 proteins)
  6. Protein UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD [53246] (1 species)
  7. Species Escherichia coli [TaxId:562] [53247] (6 PDB entries)
  8. 1610469Domain d4uaga2: 4uag A:298-437 [33952]
    Other proteins in same PDB: d4uaga1, d4uaga3
    complexed with so4, uag, unx

Details for d4uaga2

PDB Entry: 4uag (more details), 1.66 Å

PDB Description: udp-n-acetylmuramoyl-l-alanine:d-glutamate ligase
PDB Compounds: (A:) udp-n-acetylmuramoyl-l-alanine:d-glutamate ligase

SCOPe Domain Sequences for d4uaga2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4uaga2 c.59.1.1 (A:298-437) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]}
glphrfevvlehngvrwindskatnvgsteaalnglhvdgtlhlllggdgksadfsplar
ylngdnvrlycfgrdgaqlaalrpevaeqtetmeqamrllaprvqpgdmvllspacasld
qfknfeqrgnefarlakelg

SCOPe Domain Coordinates for d4uaga2:

Click to download the PDB-style file with coordinates for d4uaga2.
(The format of our PDB-style files is described here.)

Timeline for d4uaga2: