| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.5: MurCD N-terminal domain [51983] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; incomplete Rossmann-like fold; binds UDP group |
Superfamily c.5.1: MurCD N-terminal domain [51984] (2 families) ![]() |
| Family c.5.1.0: automated matches [254240] (1 protein) not a true family |
| Protein automated matches [254548] (3 species) not a true protein |
| Species Escherichia coli [TaxId:562] [255257] (8 PDB entries) |
| Domain d2uupa1: 2uup A:1-93 [152200] Other proteins in same PDB: d2uupa2, d2uupa3 automated match to d4uaga1 complexed with lk4, so4 |
PDB Entry: 2uup (more details), 1.88 Å
SCOPe Domain Sequences for d2uupa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2uupa1 c.5.1.0 (A:1-93) automated matches {Escherichia coli [TaxId: 562]}
adyqgknvviiglgltglscvdfflargvtprvmdtrmtppgldklpeaverhtgslnde
wlmaadlivaspgialahpslsaaadagieivg
Timeline for d2uupa1: