![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
![]() | Superfamily b.34.2: SH3-domain [50044] (2 families) ![]() |
![]() | Family b.34.2.1: SH3-domain [50045] (40 proteins) |
![]() | Protein automated matches [190043] (8 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [187043] (7 PDB entries) |
![]() | Domain d2rnaa2: 2rna A:171-232 [152171] Other proteins in same PDB: d2rnaa3 automated match to d3h0ha_ |
PDB Entry: 2rna (more details)
SCOPe Domain Sequences for d2rnaa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2rnaa2 b.34.2.1 (A:171-232) automated matches {Mouse (Mus musculus) [TaxId: 10090]} peetlvialydyqtndpqelalrcdeeyylldsseihwwrvqdknghegyapssylveks pn
Timeline for d2rnaa2: