Lineage for d2rnaa1 (2rna A:176-228)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 796060Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 796151Superfamily b.34.2: SH3-domain [50044] (1 family) (S)
  5. 796152Family b.34.2.1: SH3-domain [50045] (39 proteins)
  6. 796208Protein Bruton's tyrosine kinase [50068] (2 species)
  7. 796213Species Mus musculus [TaxId:10090] [159018] (2 PDB entries)
  8. 796215Domain d2rnaa1: 2rna A:176-228 [152171]
    automatically matched to d1awwa_

Details for d2rnaa1

PDB Entry: 2rna (more details)

PDB Description: itk sh3 average minimized
PDB Compounds: (A:) Tyrosine-protein kinase ITK/TSK

SCOP Domain Sequences for d2rnaa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rnaa1 b.34.2.1 (A:176-228) Bruton's tyrosine kinase {Mus musculus [TaxId: 10090]}
vialydyqtndpqelalrcdeeyylldsseihwwrvqdknghegyapssylve

SCOP Domain Coordinates for d2rnaa1:

Click to download the PDB-style file with coordinates for d2rnaa1.
(The format of our PDB-style files is described here.)

Timeline for d2rnaa1: