![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
![]() | Superfamily b.34.2: SH3-domain [50044] (1 family) ![]() |
![]() | Family b.34.2.1: SH3-domain [50045] (39 proteins) |
![]() | Protein Bruton's tyrosine kinase [50068] (2 species) |
![]() | Species Mus musculus [TaxId:10090] [159018] (2 PDB entries) |
![]() | Domain d2rnaa1: 2rna A:176-228 [152171] automatically matched to d1awwa_ |
PDB Entry: 2rna (more details)
SCOP Domain Sequences for d2rnaa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2rnaa1 b.34.2.1 (A:176-228) Bruton's tyrosine kinase {Mus musculus [TaxId: 10090]} vialydyqtndpqelalrcdeeyylldsseihwwrvqdknghegyapssylve
Timeline for d2rnaa1: