PDB entry 2rna

View 2rna on RCSB PDB site
Description: Itk SH3 average minimized
Class: Transferase
Keywords: Itk, SH3, beta barrel, 310 helix, regulatory, ATP-binding, Kinase, Membrane, Metal-binding, Nucleotide-binding, Phosphoprotein, SH2 domain, SH3 domain, Transferase, Tyrosine-protein kinase, Zinc, Zinc-finger
Deposited on 2007-12-08, released 2007-12-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosine-protein kinase ITK/TSK
    Species: Mus musculus [TaxId:10090]
    Gene: Itk, Emt, Tlk, Tsk
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q03526 (2-63)
      • expression tag (0-1)
    Domains in SCOPe 2.08: d2rnaa2, d2rnaa3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2rnaA (A:)
    gspeetlvialydyqtndpqelalrcdeeyylldsseihwwrvqdknghegyapssylve
    kspn