SCOPe 2.08: Domain d2r93h1: 2r93 H:2-146

Lineage for d2r93h1 (2r93 H:2-146)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.40: OB-fold [50198] (17 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families)

5. Family b.40.4.8: RNA polymerase subunit RBP8 [50321] (1 protein)
   duplication; contains tandem repeat of two incomplete OB-folds; forms a single barrel; n=8, S=10
   automatically mapped to Pfam PF03870

6. Protein RNA polymerase subunit RBP8 [50322] (2 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [50323] (36 PDB entries)
   Uniprot P20436

8. Domain d2r93h1: 2r93 H:2-146 [151759]
   Other proteins in same PDB: d2r93a1, d2r93b1, d2r93d1, d2r93f1, d2r93g1, d2r93j1, d2r93k1, d2r93l1
   automatically matched to d1a1da_
   protein/DNA complex; protein/RNA complex; complexed with mg, zn

Details for d2r93h1

PDB Entry: 2r93, 4 Å

PDB Description: elongation complex of rna polymerase ii with a hepatitis delta virus- derived rna stem loop

PDB Compounds: (H:) DNA-directed RNA polymerases I, II, and III subunit RPABC3

SCOPe Domain Sequences for d2r93h1:

Sequence, based on SEQRES records:

>d2r93h1 b.40.4.8 (H:2-146) RNA polymerase subunit RBP8 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sntlfddifqvsevdpgrynkvcrieaasttqdqckltldinvelfpvaaqdsltvtias
slnledtpandssatrswrppqagdrsladdydyvmygtaykfeevskdliavyysfggl
lmrlegnyrnlnnlkqenayllirr

Sequence, based on observed residues (ATOM records):

>d2r93h1 b.40.4.8 (H:2-146) RNA polymerase subunit RBP8 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sntlfddifqvsevdpgrynkvcrieaasttqdqckltldinvelfpvaaqdsltvtias
slnltrswrppqagdrsladdydyvmygtaykfeevskdliavyysfggllmrlegnyrn
lnnlkqenayllirr

Timeline for d2r93h1:

• d2r93h1 first appeared in SCOP 1.75
  
• d2r93h1 appears in SCOPe 2.07