![]() | Class i: Low resolution protein structures [58117] (25 folds) |
![]() | Fold i.8: RNA polymerase [58180] (1 superfamily) |
![]() | Superfamily i.8.1: RNA polymerase [58181] (1 family) ![]() |
![]() | Family i.8.1.1: RNA polymerase [58182] (2 proteins) |
![]() | Protein Complete 12-subunit RNA polymerase II complex [90261] (1 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [90262] (23 PDB entries) |
![]() | Domain d2r93g1: 2r93 G:1-171 [151758] Other proteins in same PDB: d2r93b1, d2r93f1, d2r93h1, d2r93j1, d2r93l1 automatically matched to d1wcmg_ protein/DNA complex; protein/RNA complex; complexed with mg, zn |
PDB Entry: 2r93 (more details), 4 Å
SCOPe Domain Sequences for d2r93g1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2r93g1 i.8.1.1 (G:1-171) Complete 12-subunit RNA polymerase II complex {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} mffikdlslnitlhpsffgprmkqylktklleevegsctgkfgyilcvldydnidiqrgr ilptdgsaefnvkyravvfkpfkgevvdgtvvscsqhgfevqvgpmkvfvtkhlmpqdlt fnagsnppsyqssedvitiksrirvkiegcisqvssihaigsikedylgai
Timeline for d2r93g1: