SCOPe 2.08: Domain d2r83b1: 2r83 B:268-418

Lineage for d2r83b1 (2r83 B:268-418)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.7: C2 domain-like [49561] (5 superfamilies)
   sandwich; 8 strands in 2 sheets; greek-key

4. Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (4 families)
   two constituent families are related by circular permutation

5. Family b.7.1.2: Synaptotagmin-like (S variant) [49575] (11 proteins)
   topologically similar to the C-terminal domain of PapD

6. Protein Synaptogamin I [49576] (3 species)
   duplication: contains tandem repeat of two similar domains

7. Species Human (Homo sapiens) [TaxId:9606] [158946] (14 PDB entries)

8. Domain d2r83b1: 2r83 B:268-418 [151671]
   automated match to d1dqva2
   complexed with cl

Details for d2r83b1

PDB Entry: 2r83, 2.7 Å

PDB Description: crystal structure analysis of human synaptotagmin 1 c2a-c2b

PDB Compounds: (B:) Synaptotagmin-1

SCOPe Domain Sequences for d2r83b1:

Sequence; same for both SEQRES and ATOM records:

>d2r83b1 b.7.1.2 (B:268-418) Synaptogamin I {Human (Homo sapiens) [TaxId: 9606]}
eeqeklgdicfslryvptagkltvvileaknlkkmdvgglsdpyvkihlmqngkrlkkkk
ttikkntlnpyynesfsfevpfeqiqkvqvvvtvldydkigkndaigkvfvgynstgael
rhwsdmlanprrpiaqwhtlqveeevdamla

Timeline for d2r83b1:

• d2r83b1 first appeared in SCOP 1.75
  
• d2r83b1 appears in SCOPe 2.07