Lineage for d2r83b1 (2r83 B:271-393)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 792147Fold b.7: C2 domain-like [49561] (5 superfamilies)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 792148Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (2 families) (S)
    two constituent families are related by circular permutation
  5. 792220Family b.7.1.2: Synaptotagmin-like (S variant) [49575] (10 protein domains)
    topologically similar to the C-terminal domain of PapD
  6. 792244Protein Synaptogamin I [49576] (2 species)
    duplication: contains tandem repeat of two similar domains
  7. 792245Species Homo sapiens [TaxId:9606] [158946] (1 PDB entry)
  8. 792247Domain d2r83b1: 2r83 B:271-393 [151671]
    automatically matched to d1byna_
    complexed with cl

Details for d2r83b1

PDB Entry: 2r83 (more details), 2.7 Å

PDB Description: Crystal structure analysis of human synaptotagmin 1 C2A-C2B
PDB Compounds: (B:) Synaptotagmin-1

SCOP Domain Sequences for d2r83b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2r83b1 b.7.1.2 (B:271-393) Synaptogamin I {Homo sapiens [TaxId: 9606]}
eklgdicfslryvptagkltvvileaknlkkmdvgglsdpyvkihlmqngkrlkkkktti
kkntlnpyynesfsfevpfeqiqkvqvvvtvldydkigkndaigkvfvgynstgaelrhw
sdm

SCOP Domain Coordinates for d2r83b1:

Click to download the PDB-style file with coordinates for d2r83b1.
(The format of our PDB-style files is described here.)

Timeline for d2r83b1: